Lineage for d1j11c2 (1j11 C:1-417)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 571086Superfamily c.1.8: (Trans)glycosidases [51445] (13 families) (S)
  5. 571087Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 571214Protein Bacterial beta-amylase [51485] (1 species)
    protein contains additional starch-binding domain
  7. 571215Species Bacillus cereus [TaxId:1396] [51486] (10 PDB entries)
  8. 571224Domain d1j11c2: 1j11 C:1-417 [83945]
    Other proteins in same PDB: d1j11a1, d1j11b1, d1j11c1, d1j11d1

Details for d1j11c2

PDB Entry: 1j11 (more details), 2 Å

PDB Description: beta-amylase from bacillus cereus var. mycoides in complex with alpha- epg

SCOP Domain Sequences for d1j11c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j11c2 c.1.8.1 (C:1-417) Bacterial beta-amylase {Bacillus cereus}
avngkgmnpdykaylmaplkkipevtnwetfendlrwakqngfyaitvdfwwgdmekngd
qqfdfsyaqrfaqsvknagmkmipiisthqcggnvgddcnvpipswvwnqksddslyfks
etgtvnketlnplasdvirkeygelytafaaamkpykdviakiylsggpagelrypsytt
sdgtgypsrgkfqaytefakskfrlwvlnkygslnevnkawgtkliselailppsdgeqf
lmngylsmygkdylewyqgilenhtkligelahnafdttfqvpigakiagvhwqynnpti
phgaekpagyndyshlldafksakldvtftclemtdkgsypeysmpktlvqniatlanek
givlngenalsigneeeykrvaemafnynfagftllryqdvmynnslmgkfkdllgv

SCOP Domain Coordinates for d1j11c2:

Click to download the PDB-style file with coordinates for d1j11c2.
(The format of our PDB-style files is described here.)

Timeline for d1j11c2: