SCOPe 2.07: Domain d1j11b1: 1j11 B:418-516

Lineage for d1j11b1 (1j11 B:418-516)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.1: Starch-binding domain-like [49452] (4 families)

5. Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
   automatically mapped to Pfam PF00686

6. Protein beta-amylase [49462] (1 species)

7. Species Bacillus cereus [TaxId:1396] [49463] (12 PDB entries)

8. Domain d1j11b1: 1j11 B:418-516 [83942]
   Other proteins in same PDB: d1j11a2, d1j11b2, d1j11c2, d1j11d2
   complexed with ca, epg

Details for d1j11b1

PDB Entry: 1j11, 2 Å

PDB Description: beta-amylase from bacillus cereus var. mycoides in complex with alpha- epg

PDB Compounds: (B:) beta-amylase

SCOPe Domain Sequences for d1j11b1:

Sequence; same for both SEQRES and ATOM records:

>d1j11b1 b.3.1.1 (B:418-516) beta-amylase {Bacillus cereus [TaxId: 1396]}
tpvmqtivvknvpttigdtvyitgnraelgswdtkqypiqlyydshsndwrgnvvlpaer
niefkafikskdgtvkswqtiqqswnpvplkttshtssw

Timeline for d1j11b1:

• d1j11b1 first appeared in SCOP 1.65
  
• d1j11b1 appears in SCOPe 2.06
  
• d1j11b1 appears in the current release, SCOPe 2.08