Lineage for d1j11a2 (1j11 A:1-417)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 305661Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 305662Family c.1.8.1: Amylase, catalytic domain [51446] (22 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 305772Protein Bacterial beta-amylase [51485] (1 species)
    protein contains additional starch-binding domain
  7. 305773Species Bacillus cereus [TaxId:1396] [51486] (10 PDB entries)
  8. 305780Domain d1j11a2: 1j11 A:1-417 [83941]
    Other proteins in same PDB: d1j11a1, d1j11b1, d1j11c1, d1j11d1

Details for d1j11a2

PDB Entry: 1j11 (more details), 2 Å

PDB Description: beta-amylase from bacillus cereus var. mycoides in complex with alpha- epg

SCOP Domain Sequences for d1j11a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j11a2 c.1.8.1 (A:1-417) Bacterial beta-amylase {Bacillus cereus}
avngkgmnpdykaylmaplkkipevtnwetfendlrwakqngfyaitvdfwwgdmekngd
qqfdfsyaqrfaqsvknagmkmipiisthqcggnvgddcnvpipswvwnqksddslyfks
etgtvnketlnplasdvirkeygelytafaaamkpykdviakiylsggpagelrypsytt
sdgtgypsrgkfqaytefakskfrlwvlnkygslnevnkawgtkliselailppsdgeqf
lmngylsmygkdylewyqgilenhtkligelahnafdttfqvpigakiagvhwqynnpti
phgaekpagyndyshlldafksakldvtftclemtdkgsypeysmpktlvqniatlanek
givlngenalsigneeeykrvaemafnynfagftllryqdvmynnslmgkfkdllgv

SCOP Domain Coordinates for d1j11a2:

Click to download the PDB-style file with coordinates for d1j11a2.
(The format of our PDB-style files is described here.)

Timeline for d1j11a2: