Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein Bacterial beta-amylase [51485] (1 species) protein contains additional starch-binding domain |
Species Bacillus cereus [TaxId:1396] [51486] (11 PDB entries) |
Domain d1j0zb2: 1j0z B:1-417 [83927] Other proteins in same PDB: d1j0za1, d1j0zb1, d1j0zc1, d1j0zd1 complexed with ca has additional subdomain(s) that are not in the common domain |
PDB Entry: 1j0z (more details), 2.2 Å
SCOPe Domain Sequences for d1j0zb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j0zb2 c.1.8.1 (B:1-417) Bacterial beta-amylase {Bacillus cereus [TaxId: 1396]} avngkgmnpdykaylmaplkkipevtnwetfendlrwakqngfyaitvdfwwgdmekngd qqfdfsyaqrfaqsvknagmkmipiisthqcggnvgddcnvpipswvwnqksddslyfks etgtvnketlnplasdvirkeygelytafaaamkpykdviakiylsggpagelrypsytt sdgtgypsrgkfqaytefakskfrlwvlnkygslnevnkawgtkliselailppsdgeqf lmngylsmygkdylewyqgilenhtkligelahnafdttfqvpigakiagvhwqynnpti phgaekpagyndyshlldafksakldvtftclemtdkgsypeysmpktlvqniatlanek givlngenalsigneeeykrvaemafnynfagftllryqdvmynnslmgkfkdllgv
Timeline for d1j0zb2: