Lineage for d1j0zb1 (1j0z B:418-516)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 790366Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 790367Superfamily b.3.1: Starch-binding domain-like [49452] (3 families) (S)
  5. 790368Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
  6. 790369Protein beta-amylase [49462] (1 species)
  7. 790370Species Bacillus cereus [TaxId:1396] [49463] (15 PDB entries)
  8. 790394Domain d1j0zb1: 1j0z B:418-516 [83926]
    Other proteins in same PDB: d1j0za2, d1j0zb2, d1j0zc2, d1j0zd2

Details for d1j0zb1

PDB Entry: 1j0z (more details), 2.2 Å

PDB Description: beta-amylase from bacillus cereus var. mycoides in complex with maltose
PDB Compounds: (B:) beta-amylase

SCOP Domain Sequences for d1j0zb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j0zb1 b.3.1.1 (B:418-516) beta-amylase {Bacillus cereus [TaxId: 1396]}
tpvmqtivvknvpttigdtvyitgnraelgswdtkqypiqlyydshsndwrgnvvlpaer
niefkafikskdgtvkswqtiqqswnpvplkttshtssw

SCOP Domain Coordinates for d1j0zb1:

Click to download the PDB-style file with coordinates for d1j0zb1.
(The format of our PDB-style files is described here.)

Timeline for d1j0zb1: