SCOP 1.71: Domain d1j0zb1: 1j0z B:418-516

Lineage for d1j0zb1 (1j0z B:418-516)

Root: SCOP 1.71
Class b: All beta proteins [48724] (149 folds)
Fold b.3: Prealbumin-like [49451] (7 superfamilies)
sandwich; 7 strands in 2 sheets, greek-key
variations: some members have additional 1-2 strands to common fold
Superfamily b.3.1: Starch-binding domain-like [49452] (2 families)
Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
Protein beta-amylase [49462] (1 species)
Species Bacillus cereus [TaxId:1396] [49463] (11 PDB entries)
Domain d1j0zb1: 1j0z B:418-516 [83926]
Other proteins in same PDB: d1j0za2, d1j0zb2, d1j0zc2, d1j0zd2

Details for d1j0zb1

PDB Entry: 1j0z (more details), 2.2 Å

PDB Description: beta-amylase from bacillus cereus var. mycoides in complex with maltose

SCOP Domain Sequences for d1j0zb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j0zb1 b.3.1.1 (B:418-516) beta-amylase {Bacillus cereus}
tpvmqtivvknvpttigdtvyitgnraelgswdtkqypiqlyydshsndwrgnvvlpaer
niefkafikskdgtvkswqtiqqswnpvplkttshtssw

SCOP Domain Coordinates for d1j0zb1:

Click to download the PDB-style file with coordinates for d1j0zb1.
(The format of our PDB-style files is described here.)

Timeline for d1j0zb1: