SCOP 1.65: Domain d1j0yc2: 1j0y C:1-417

Lineage for d1j0yc2 (1j0y C:1-417)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (9 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (22 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Bacterial beta-amylase [51485] (1 species)
   protein contains additional starch-binding domain

7. Species Bacillus cereus [TaxId:1396] [51486] (10 PDB entries)

8. Domain d1j0yc2: 1j0y C:1-417 [83921]
   Other proteins in same PDB: d1j0ya1, d1j0yb1, d1j0yc1, d1j0yd1

Details for d1j0yc2

PDB Entry: 1j0y, 2.1 Å

PDB Description: beta-amylase from bacillus cereus var. mycoides in complex with glucose

SCOP Domain Sequences for d1j0yc2:

Sequence; same for both SEQRES and ATOM records:

>d1j0yc2 c.1.8.1 (C:1-417) Bacterial beta-amylase {Bacillus cereus}
avngkgmnpdykaylmaplkkipevtnwetfendlrwakqngfyaitvdfwwgdmekngd
qqfdfsyaqrfaqsvknagmkmipiisthqcggnvgddcnvpipswvwnqksddslyfks
etgtvnketlnplasdvirkeygelytafaaamkpykdviakiylsggpagelrypsytt
sdgtgypsrgkfqaytefakskfrlwvlnkygslnevnkawgtkliselailppsdgeqf
lmngylsmygkdylewyqgilenhtkligelahnafdttfqvpigakiagvhwqynnpti
phgaekpagyndyshlldafksakldvtftclemtdkgsypeysmpktlvqniatlanek
givlngenalsigneeeykrvaemafnynfagftllryqdvmynnslmgkfkdllgv

Timeline for d1j0yc2:

• d1j0yc2 is new in SCOP 1.65
  
• d1j0yc2 appears in SCOP 1.67
  
• d1j0yc2 appears in the current release, SCOPe 2.08