Lineage for d1j0yb1 (1j0y B:418-516)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768598Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) (S)
  5. 2768599Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
    automatically mapped to Pfam PF00686
  6. 2768600Protein beta-amylase [49462] (1 species)
  7. 2768601Species Bacillus cereus [TaxId:1396] [49463] (12 PDB entries)
  8. 2768614Domain d1j0yb1: 1j0y B:418-516 [83918]
    Other proteins in same PDB: d1j0ya2, d1j0yb2, d1j0yc2, d1j0yd2
    complexed with bgc, ca

Details for d1j0yb1

PDB Entry: 1j0y (more details), 2.1 Å

PDB Description: beta-amylase from bacillus cereus var. mycoides in complex with glucose
PDB Compounds: (B:) beta-amylase

SCOPe Domain Sequences for d1j0yb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j0yb1 b.3.1.1 (B:418-516) beta-amylase {Bacillus cereus [TaxId: 1396]}
tpvmqtivvknvpttigdtvyitgnraelgswdtkqypiqlyydshsndwrgnvvlpaer
niefkafikskdgtvkswqtiqqswnpvplkttshtssw

SCOPe Domain Coordinates for d1j0yb1:

Click to download the PDB-style file with coordinates for d1j0yb1.
(The format of our PDB-style files is described here.)

Timeline for d1j0yb1: