Lineage for d1j0ya1 (1j0y A:418-516)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 292233Fold b.3: Prealbumin-like [49451] (6 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 292234Superfamily b.3.1: Starch-binding domain [49452] (1 family) (S)
  5. 292235Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
  6. 292236Protein beta-amylase [49462] (1 species)
  7. 292237Species Bacillus cereus [TaxId:1396] [49463] (11 PDB entries)
  8. 292241Domain d1j0ya1: 1j0y A:418-516 [83916]
    Other proteins in same PDB: d1j0ya2, d1j0yb2, d1j0yc2, d1j0yd2

Details for d1j0ya1

PDB Entry: 1j0y (more details), 2.1 Å

PDB Description: beta-amylase from bacillus cereus var. mycoides in complex with glucose

SCOP Domain Sequences for d1j0ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j0ya1 b.3.1.1 (A:418-516) beta-amylase {Bacillus cereus}
tpvmqtivvknvpttigdtvyitgnraelgswdtkqypiqlyydshsndwrgnvvlpaer
niefkafikskdgtvkswqtiqqswnpvplkttshtssw

SCOP Domain Coordinates for d1j0ya1:

Click to download the PDB-style file with coordinates for d1j0ya1.
(The format of our PDB-style files is described here.)

Timeline for d1j0ya1: