Lineage for d1j0na3 (1j0n A:387-659)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 795365Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 795492Superfamily b.30.5: Galactose mutarotase-like [74650] (11 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 795635Family b.30.5.2: Hyaluronate lyase-like, central domain [50006] (4 proteins)
  6. 795678Protein Xanthan lyase [89282] (1 species)
  7. 795679Species Bacillus sp. gl1 [TaxId:84635] [89283] (7 PDB entries)
  8. 795686Domain d1j0na3: 1j0n A:387-659 [83915]
    Other proteins in same PDB: d1j0na1, d1j0na2
    complexed with ca, ceg

Details for d1j0na3

PDB Entry: 1j0n (more details), 2.4 Å

PDB Description: crystal structure of bacillus sp. gl1 xanthan lyase that acts on side chains of xanthan
PDB Compounds: (A:) xanthan lyase

SCOP Domain Sequences for d1j0na3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j0na3 b.30.5.2 (A:387-659) Xanthan lyase {Bacillus sp. gl1 [TaxId: 84635]}
pnlykqyaamdravlqrpgfalglalystrissyesinsengrgwytgagatylynqdla
qysedywptvdayripgttvasgtpiasgtgtsswtggvslagqygasgmdlsygaynls
arkswfmfddeivalgsgisstagipietvvdnrklngagdnawtangaalstglgvaqt
ltgvnwvhlagntadgsdigyyfpggatlqtkreartgtwkqinnrpatpstavtrnyet
mwidhgtnpsgasygyvllpnktsaqvgayaad

SCOP Domain Coordinates for d1j0na3:

Click to download the PDB-style file with coordinates for d1j0na3.
(The format of our PDB-style files is described here.)

Timeline for d1j0na3: