Lineage for d1j0na2 (1j0n A:660-777)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1306780Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (1 superfamily)
    sandwich, 10 strands in 2 sheets; "folded meander"
  4. 1306781Superfamily b.24.1: Hyaluronate lyase-like, C-terminal domain [49863] (1 family) (S)
  5. 1306782Family b.24.1.1: Hyaluronate lyase-like, C-terminal domain [49864] (4 proteins)
  6. 1306825Protein Xanthan lyase [89264] (1 species)
  7. 1306826Species Bacillus sp. GL1 [TaxId:84635] [89265] (7 PDB entries)
  8. 1306833Domain d1j0na2: 1j0n A:660-777 [83914]
    Other proteins in same PDB: d1j0na1, d1j0na3
    complexed with ca, ceg

Details for d1j0na2

PDB Entry: 1j0n (more details), 2.4 Å

PDB Description: crystal structure of bacillus sp. gl1 xanthan lyase that acts on side chains of xanthan
PDB Compounds: (A:) xanthan lyase

SCOPe Domain Sequences for d1j0na2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j0na2 b.24.1.1 (A:660-777) Xanthan lyase {Bacillus sp. GL1 [TaxId: 84635]}
paieivvntsgvqsvkektlglvganfwtdttqtadlitsnkkasvmtreiaderleasv
sdptqanngtiaielarsaegysadpgitvtqlaptikftvnvngakgksfhasfqlg

SCOPe Domain Coordinates for d1j0na2:

Click to download the PDB-style file with coordinates for d1j0na2.
(The format of our PDB-style files is described here.)

Timeline for d1j0na2: