![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (1 superfamily) sandwich, 10 strands in 2 sheets; "folded meander" |
![]() | Superfamily b.24.1: Hyaluronate lyase-like, C-terminal domain [49863] (1 family) ![]() |
![]() | Family b.24.1.1: Hyaluronate lyase-like, C-terminal domain [49864] (4 proteins) |
![]() | Protein Xanthan lyase [89264] (1 species) |
![]() | Species Bacillus sp. gl1 [TaxId:84635] [89265] (2 PDB entries) |
![]() | Domain d1j0ma2: 1j0m A:660-777 [83911] Other proteins in same PDB: d1j0ma1, d1j0ma3 complexed with ca |
PDB Entry: 1j0m (more details), 2.3 Å
SCOP Domain Sequences for d1j0ma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j0ma2 b.24.1.1 (A:660-777) Xanthan lyase {Bacillus sp. gl1} paieivvntsgvqsvkektlglvganfwtdttqtadlitsnkkasvmtreiaderleasv sdptqanngtiaielarsaegysadpgitvtqlaptikftvnvngakgksfhasfqlg
Timeline for d1j0ma2: