Lineage for d1j0ma2 (1j0m A:660-777)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777794Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (2 superfamilies)
    sandwich, 10 strands in 2 sheets; "folded meander"
  4. 2777795Superfamily b.24.1: Hyaluronate lyase-like, C-terminal domain [49863] (2 families) (S)
  5. 2777796Family b.24.1.1: Hyaluronate lyase-like, C-terminal domain [49864] (4 proteins)
  6. Protein Xanthan lyase [89264] (1 species)
  7. Species Bacillus sp. GL1 [TaxId:84635] [89265] (2 PDB entries)
  8. 2777842Domain d1j0ma2: 1j0m A:660-777 [83911]
    Other proteins in same PDB: d1j0ma1, d1j0ma3
    complexed with ca

Details for d1j0ma2

PDB Entry: 1j0m (more details), 2.3 Å

PDB Description: crystal structure of bacillus sp. gl1 xanthan lyase that acts on side chains of xanthan
PDB Compounds: (A:) xanthan lyase

SCOPe Domain Sequences for d1j0ma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j0ma2 b.24.1.1 (A:660-777) Xanthan lyase {Bacillus sp. GL1 [TaxId: 84635]}
paieivvntsgvqsvkektlglvganfwtdttqtadlitsnkkasvmtreiaderleasv
sdptqanngtiaielarsaegysadpgitvtqlaptikftvnvngakgksfhasfqlg

SCOPe Domain Coordinates for d1j0ma2:

Click to download the PDB-style file with coordinates for d1j0ma2.
(The format of our PDB-style files is described here.)

Timeline for d1j0ma2: