Lineage for d1j0ma1 (1j0m A:26-386)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722434Superfamily a.102.3: Chondroitin AC/alginate lyase [48230] (2 families) (S)
    incomplete toroid
  5. 2722452Family a.102.3.2: Hyaluronate lyase-like catalytic, N-terminal domain [48234] (5 proteins)
  6. Protein Xanthan lyase [89111] (1 species)
  7. Species Bacillus sp. GL1 [TaxId:84635] [89112] (2 PDB entries)
  8. 2722498Domain d1j0ma1: 1j0m A:26-386 [83910]
    Other proteins in same PDB: d1j0ma2, d1j0ma3
    complexed with ca

Details for d1j0ma1

PDB Entry: 1j0m (more details), 2.3 Å

PDB Description: crystal structure of bacillus sp. gl1 xanthan lyase that acts on side chains of xanthan
PDB Compounds: (A:) xanthan lyase

SCOPe Domain Sequences for d1j0ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j0ma1 a.102.3.2 (A:26-386) Xanthan lyase {Bacillus sp. GL1 [TaxId: 84635]}
sdefdalrikwatlltggpaldpadsdiaartdklaqdandywedmdlsssrtyiwyalr
gngtsdnvnavyerlrtmalaattvgsslygnadlkedildaldwlyvnsynstrsrsay
nwwhwqlgipmslndtavllyddisaarmatymdtidyftpsigltganrawqaivvgvr
avivkdavklaaarnglsgtgifpyatggdgfyadgsfvqhttfaytggygssvlettan
lmyllsgstwsvsdpnqsnvwqwiyeayrpllykgammdmvrgreisrsyaqdhavghgi
vasivrlaqfapaphaaafkqiakrviqedtfssfygdvstdtirlakaivddpsiapaa
a

SCOPe Domain Coordinates for d1j0ma1:

Click to download the PDB-style file with coordinates for d1j0ma1.
(The format of our PDB-style files is described here.)

Timeline for d1j0ma1: