Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) |
Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins) |
Protein 1-aminocyclopropane-1-carboxylate deaminase [53694] (3 species) |
Species Yeast (Hansenula saturnus) [TaxId:4906] [53695] (4 PDB entries) |
Domain d1j0eb_: 1j0e B: [83907] complexed with 1ac, plp; mutant |
PDB Entry: 1j0e (more details), 2.45 Å
SCOPe Domain Sequences for d1j0eb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j0eb_ c.79.1.1 (B:) 1-aminocyclopropane-1-carboxylate deaminase {Yeast (Hansenula saturnus) [TaxId: 4906]} agvakfakypltfgpspisnlnrlsqhlgskvnvyakredcnsglafggnklrkleyivp divegdythlvsiggrqsnqtrmvaalaaklgkkcvliqedwvpipeaekdvynrvgnie lsrimgadvrviedgfdigmrksfanalqeledaghkpypipagcsehkygglgfvgfad evinqevelgikfdkivvccvtgsttagilagmaqygrqddviaidasftsektkeqtlr ianntakligvehefkdftldtrfaypcygvpnegtieairtcaeqegvltdpvfegksm qglialikedyfkpganvlyvhlggapalsayssffptkta
Timeline for d1j0eb_: