SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1j0bm_ (1j0b M:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139769Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2139770Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2139771Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 protein domains)
  6. 2139772Protein 1-aminocyclopropane-1-carboxylate deaminase [53694] (3 species)
  7. 2139798Species Pyrococcus horikoshii [TaxId:53953] [89777] (2 PDB entries)
  8. 2139814Domain d1j0bm_: 1j0b M: [83886]
    complexed with 5pa

Details for d1j0bm_

PDB Entry: 1j0b (more details), 2.7 Å

PDB Description: Crystal Structure Analysis of the ACC deaminase homologue complexed with inhibitor
PDB Compounds: (M:) 1-aminocyclopropane-1-carboxylate deaminase

SCOPe Domain Sequences for d1j0bm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j0bm_ c.79.1.1 (M:) 1-aminocyclopropane-1-carboxylate deaminase {Pyrococcus horikoshii [TaxId: 53953]}
mhpkifallakfprvelipwetpiqylpnisreigadvyikrddltglgiggnkirkley
llgdalskgadvvitvgavhsnhafvtglaakklgldailvlrgkeelkgnylldkimgi
etrvydakdsfelmkyaeeiaeelkregrkpyvippggaspigtlgyvravgeiatqsev
kfdsivvaagsggtlaglslglsilnedirpvgiavgrfgevmtskldnlikeaaellgv
kvevrpelydysfgeygkitgevaqiirkvgtregiildpvytgkafyglvdlarkgelg
ekilfihtggisgtfhygdkllsll

SCOPe Domain Coordinates for d1j0bm_:

Click to download the PDB-style file with coordinates for d1j0bm_.
(The format of our PDB-style files is described here.)

Timeline for d1j0bm_: