Lineage for d1j0be_ (1j0b E:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 320763Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 320764Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) (S)
  5. 320765Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (6 proteins)
  6. 320766Protein 1-aminocyclopropane-1-carboxylate deaminase [53694] (2 species)
  7. 320767Species Archaeon Pyrococcus horikoshii [TaxId:53953] [89777] (2 PDB entries)
  8. 320775Domain d1j0be_: 1j0b E: [83878]

Details for d1j0be_

PDB Entry: 1j0b (more details), 2.7 Å

PDB Description: Crystal Structure Analysis of the ACC deaminase homologue complexed with inhibitor

SCOP Domain Sequences for d1j0be_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j0be_ c.79.1.1 (E:) 1-aminocyclopropane-1-carboxylate deaminase {Archaeon Pyrococcus horikoshii}
mhpkifallakfprvelipwetpiqylpnisreigadvyikrddltglgiggnkirkley
llgdalskgadvvitvgavhsnhafvtglaakklgldailvlrgkeelkgnylldkimgi
etrvydakdsfelmkyaeeiaeelkregrkpyvippggaspigtlgyvravgeiatqsev
kfdsivvaagsggtlaglslglsilnedirpvgiavgrfgevmtskldnlikeaaellgv
kvevrpelydysfgeygkitgevaqiirkvgtregiildpvytgkafyglvdlarkgelg
ekilfihtggisgtfhygdkllsll

SCOP Domain Coordinates for d1j0be_:

Click to download the PDB-style file with coordinates for d1j0be_.
(The format of our PDB-style files is described here.)

Timeline for d1j0be_: