Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) |
Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (8 proteins) |
Protein 1-aminocyclopropane-1-carboxylate deaminase [53694] (3 species) |
Species Archaeon Pyrococcus horikoshii [TaxId:53953] [89777] (2 PDB entries) |
Domain d1j0bc_: 1j0b C: [83876] |
PDB Entry: 1j0b (more details), 2.7 Å
SCOP Domain Sequences for d1j0bc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j0bc_ c.79.1.1 (C:) 1-aminocyclopropane-1-carboxylate deaminase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} mhpkifallakfprvelipwetpiqylpnisreigadvyikrddltglgiggnkirkley llgdalskgadvvitvgavhsnhafvtglaakklgldailvlrgkeelkgnylldkimgi etrvydakdsfelmkyaeeiaeelkregrkpyvippggaspigtlgyvravgeiatqsev kfdsivvaagsggtlaglslglsilnedirpvgiavgrfgevmtskldnlikeaaellgv kvevrpelydysfgeygkitgevaqiirkvgtregiildpvytgkafyglvdlarkgelg ekilfihtggisgtfhygdkllsll
Timeline for d1j0bc_: