Lineage for d1j0aa_ (1j0a A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1387142Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 1387143Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 1387144Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 1387145Protein 1-aminocyclopropane-1-carboxylate deaminase [53694] (3 species)
  7. 1387171Species Pyrococcus horikoshii [TaxId:53953] [89777] (2 PDB entries)
  8. 1387172Domain d1j0aa_: 1j0a A: [83871]
    complexed with ipa, plp, so4

Details for d1j0aa_

PDB Entry: 1j0a (more details), 2.5 Å

PDB Description: Crystal Structure Analysis of the ACC deaminase homologue
PDB Compounds: (A:) 1-aminocyclopropane-1-carboxylate deaminase

SCOPe Domain Sequences for d1j0aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j0aa_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Pyrococcus horikoshii [TaxId: 53953]}
mhpkifallakfprvelipwetpiqylpnisreigadvyikrddltglgiggnkirkley
llgdalskgadvvitvgavhsnhafvtglaakklgldailvlrgkeelkgnylldkimgi
etrvydakdsfelmkyaeeiaeelkregrkpyvippggaspigtlgyvravgeiatqsev
kfdsivvaagsggtlaglslglsilnedirpvgiavgrfgevmtskldnlikeaaellgv
kvevrpelydysfgeygkitgevaqiirkvgtregiildpvytgkafyglvdlarkgelg
ekilfihtggisgtfhygdkllsll

SCOPe Domain Coordinates for d1j0aa_:

Click to download the PDB-style file with coordinates for d1j0aa_.
(The format of our PDB-style files is described here.)

Timeline for d1j0aa_: