SCOP 1.71: Domain d1j08d2: 1j08 D:120-226

Lineage for d1j08d2 (1j08 D:120-226)

Root: SCOP 1.71
Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
Superfamily c.47.1: Thioredoxin-like [52833] (16 families)
Family c.47.1.2: PDI-like [52849] (2 proteins)
duplication: contains two tandem repeats of this fold
Protein Protein disulfide isomerase, PDI [52850] (3 species)
Species Archaeon Pyrococcus horikoshii [TaxId:53953] [89702] (1 PDB entry)
glutaredoxin-like protein
Domain d1j08d2: 1j08 D:120-226 [83862]

Details for d1j08d2

PDB Entry: 1j08 (more details), 2.3 Å

PDB Description: Crystal structure of glutaredoxin-like protein from Pyrococcus horikoshii

SCOP Domain Sequences for d1j08d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j08d2 c.47.1.2 (D:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus horikoshii}
dlmqdskeevskidkdvrilifvtptcpycplavrmahkfaientkagkgkilgdmveai
eypewadqynvmavpkiviqvngedkvqfegaypekmflekllsals

SCOP Domain Coordinates for d1j08d2:

Click to download the PDB-style file with coordinates for d1j08d2.
(The format of our PDB-style files is described here.)

Timeline for d1j08d2: