Lineage for d1j08a2 (1j08 A:120-226)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 395822Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 395823Superfamily c.47.1: Thioredoxin-like [52833] (14 families) (S)
  5. 395960Family c.47.1.2: PDI-like [52849] (2 proteins)
    duplication: contains two tandem repeats of this fold
  6. 395965Protein Protein disulfide isomerase, PDI [52850] (3 species)
  7. 395969Species Archaeon Pyrococcus horikoshii [TaxId:53953] [89702] (1 PDB entry)
    glutaredoxin-like protein
  8. 395971Domain d1j08a2: 1j08 A:120-226 [83856]

Details for d1j08a2

PDB Entry: 1j08 (more details), 2.3 Å

PDB Description: Crystal structure of glutaredoxin-like protein from Pyrococcus horikoshii

SCOP Domain Sequences for d1j08a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j08a2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus horikoshii}
dlmqdskeevskidkdvrilifvtptcpycplavrmahkfaientkagkgkilgdmveai
eypewadqynvmavpkiviqvngedkvqfegaypekmflekllsals

SCOP Domain Coordinates for d1j08a2:

Click to download the PDB-style file with coordinates for d1j08a2.
(The format of our PDB-style files is described here.)

Timeline for d1j08a2: