Lineage for d1j00a_ (1j00 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2465640Superfamily c.23.10: SGNH hydrolase [52266] (10 families) (S)
  5. 2465694Family c.23.10.5: TAP-like [89594] (3 proteins)
    automatically mapped to Pfam PF00657
    automatically mapped to Pfam PF13472
  6. 2465698Protein Thioesterase I, TAP [89595] (1 species)
    multifunctional enzyme with thioesterase, esterase, protease and lysophospholiase activities
  7. 2465699Species Escherichia coli [TaxId:562] [89596] (5 PDB entries)
    Uniprot P29679 27-205
  8. 2465704Domain d1j00a_: 1j00 A: [83854]
    complexed with so4

Details for d1j00a_

PDB Entry: 1j00 (more details), 2 Å

PDB Description: E. coli Thioesterase I/Protease I/Lysophospholipase L1 in complexed with diethyl phosphono moiety
PDB Compounds: (A:) Thioesterase I

SCOPe Domain Sequences for d1j00a_:

Sequence, based on SEQRES records: (download)

>d1j00a_ c.23.10.5 (A:) Thioesterase I, TAP {Escherichia coli [TaxId: 562]}
adtllilgdslsagyrmsasaawpallndkwqsktsvvnasisgdtsqqglarlpallkq
hqprwvlvelggndglrgfqpqqteqtlrqilqdvkaanaepllmqirlpanygrrynea
fsaiypklakefdvpllpffmeevylkpqwmqddgihpnrdaqpfiadwmakqlqplvnh

Sequence, based on observed residues (ATOM records): (download)

>d1j00a_ c.23.10.5 (A:) Thioesterase I, TAP {Escherichia coli [TaxId: 562]}
adtllilgdslsagyrmsasaawpallndkwsktsvvnasisgdtsqqglarlpallkqh
qprwvlvelggndglrgfqpqqteqtlrqilqdvkaanaepllmqirlpanygrryneaf
saiypklakefdvpllpffmeevylkpqwmqddgihpnrdaqpfiadwmakqlqplvh

SCOPe Domain Coordinates for d1j00a_:

Click to download the PDB-style file with coordinates for d1j00a_.
(The format of our PDB-style files is described here.)

Timeline for d1j00a_: