Lineage for d1izoc_ (1izo C:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 284545Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 284546Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 284547Family a.104.1.1: Cytochrome P450 [48265] (14 proteins)
  6. 284576Protein Cytochrome p450 152a1 (Bs-beta) [89116] (1 species)
  7. 284577Species Bacillus subtilis [TaxId:1423] [89117] (1 PDB entry)
  8. 284580Domain d1izoc_: 1izo C: [83853]
    complexed with hem, pam

Details for d1izoc_

PDB Entry: 1izo (more details), 2.1 Å

PDB Description: Cytochrome P450 BS beta Complexed with Fatty Acid

SCOP Domain Sequences for d1izoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1izoc_ a.104.1.1 (C:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis}
phdksldnsltllkegylfiknrterynsdlfqarllgknficmtgaeaakvfydtdrfq
rqnalpkrvqkslfgvnaiqgmdgsahihrkmlflslmtpphqkrlaelmteewkaavtr
wekadevvlfeeakeilcrvacywagvplketevkeraddfidmvdafgavgprhwkgrr
arpraeewievmiedaragllkttsgtalhemafhtqedgsqldsrmaaielinvlrpiv
aisyflvfsalalhehpkykewlrsgnsreremfvqevrryypfgpflgalvkkdfvwnn
cefkkgtsvlldlygtnhdprlwdhpdefrperfaereenlfdmipqggghaekghrcpg
egitievmkasldflvhqieydvpeqslhyslarmpslpesgfvmsgirrk

SCOP Domain Coordinates for d1izoc_:

Click to download the PDB-style file with coordinates for d1izoc_.
(The format of our PDB-style files is described here.)

Timeline for d1izoc_: