Lineage for d1izoa_ (1izo A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005018Protein Cytochrome p450 152a1 (Bs-beta) [89116] (1 species)
  7. 2005019Species Bacillus subtilis [TaxId:1423] [89117] (1 PDB entry)
  8. 2005020Domain d1izoa_: 1izo A: [83851]
    complexed with hem, pam

Details for d1izoa_

PDB Entry: 1izo (more details), 2.1 Å

PDB Description: Cytochrome P450 BS beta Complexed with Fatty Acid
PDB Compounds: (A:) Cytochrome P450 152A1

SCOPe Domain Sequences for d1izoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]}
phdksldnsltllkegylfiknrterynsdlfqarllgknficmtgaeaakvfydtdrfq
rqnalpkrvqkslfgvnaiqgmdgsahihrkmlflslmtpphqkrlaelmteewkaavtr
wekadevvlfeeakeilcrvacywagvplketevkeraddfidmvdafgavgprhwkgrr
arpraeewievmiedaragllkttsgtalhemafhtqedgsqldsrmaaielinvlrpiv
aisyflvfsalalhehpkykewlrsgnsreremfvqevrryypfgpflgalvkkdfvwnn
cefkkgtsvlldlygtnhdprlwdhpdefrperfaereenlfdmipqggghaekghrcpg
egitievmkasldflvhqieydvpeqslhyslarmpslpesgfvmsgirrk

SCOPe Domain Coordinates for d1izoa_:

Click to download the PDB-style file with coordinates for d1izoa_.
(The format of our PDB-style files is described here.)

Timeline for d1izoa_: