![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
![]() | Fold e.43: Subunits of heterodimeric actin filament capping protein Capz [90095] (1 superfamily) 3 domains: (1) protozoan pheromone-like alpha-helical bundle; (2) rubredoxin-like domain lacking metal-binding site; (3) alpha+beta heterodimerisation domain: alpha-beta(5)-alpha |
![]() | Superfamily e.43.1: Subunits of heterodimeric actin filament capping protein Capz [90096] (3 families) ![]() |
![]() | Family e.43.1.2: Capz beta-1 subunit [90100] (2 proteins) automatically mapped to Pfam PF01115 |
![]() | Protein Capz beta-1 subunit [90101] (1 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [90102] (8 PDB entries) |
![]() | Domain d1iznd_: 1izn D: [83850] Other proteins in same PDB: d1izna_, d1iznc_ domain boundaries: B:2-46;47-88;89-271, D:2-46;47-88;89-271 complexed with no3 |
PDB Entry: 1izn (more details), 2.1 Å
SCOPe Domain Sequences for d1iznd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iznd_ e.43.1.2 (D:) Capz beta-1 subunit {Chicken (Gallus gallus) [TaxId: 9031]} sdqqldcaldlmrrlppqqieknlsdlidlvpslcedllssvdqplkiardkvvgkdyll cdynrdgdsyrspwsnkydppledgampsarlrkleveannafdqyrdlyfeggvssvyl wdldhgfagvilikkagdgskkikgcwdsihvvevqekssgrtahykltstvmlwlqtnk tgsgtmnlggsltrqmekdetvsdssphianigrlvedmenkirstlneiyfgktkdivn glrsidaipdnqkykqlqrelsqvltqrqi
Timeline for d1iznd_: