Lineage for d1izna_ (1izn A:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2625891Fold e.43: Subunits of heterodimeric actin filament capping protein Capz [90095] (1 superfamily)
    3 domains: (1) protozoan pheromone-like alpha-helical bundle; (2) rubredoxin-like domain lacking metal-binding site; (3) alpha+beta heterodimerisation domain: alpha-beta(5)-alpha
  4. 2625892Superfamily e.43.1: Subunits of heterodimeric actin filament capping protein Capz [90096] (3 families) (S)
  5. 2625893Family e.43.1.1: Capz alpha-1 subunit [90097] (1 protein)
    automatically mapped to Pfam PF01267
  6. 2625894Protein Capz alpha-1 subunit [90098] (1 species)
  7. 2625895Species Chicken (Gallus gallus) [TaxId:9031] [90099] (12 PDB entries)
  8. 2625901Domain d1izna_: 1izn A: [83847]
    Other proteins in same PDB: d1iznb_, d1iznd_
    domain boundaries: A:7-62;63-116;117-281, C:5-62;63-116;117-277
    complexed with no3

Details for d1izna_

PDB Entry: 1izn (more details), 2.1 Å

PDB Description: Crystal Structure of Actin Filament Capping Protein CapZ
PDB Compounds: (A:) CapZ alpha-1 subunit

SCOPe Domain Sequences for d1izna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1izna_ e.43.1.1 (A:) Capz alpha-1 subunit {Chicken (Gallus gallus) [TaxId: 9031]}
rvsdeekvriaakfithappgefnevfndvrlllnndnllregaahafaqynmdqftpvk
iegyddqvlitehgdlgngrfldprnkisfkfdhlrkeasdpqpedtesalkqwrdacds
alrayvkdhypngfctvygksidgqqtiiacieshqfqpknfwngrwrsewkftitppta
qvaavlkiqvhyyedgnvqlvshkdiqdsvqvssdvqtakefikiienaeneyqtaisen
yqtmsdttfkalrrqlpvtrtkidwnkilsykigk

SCOPe Domain Coordinates for d1izna_:

Click to download the PDB-style file with coordinates for d1izna_.
(The format of our PDB-style files is described here.)

Timeline for d1izna_: