SCOPe 2.05: Domain d1izea_: 1ize A:

Lineage for d1izea_ (1ize A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.2: Pepsin-like [50646] (11 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein Acid protease [50649] (9 species)

7. Species Fungus (Aspergillus oryzae) [TaxId:5062] [89352] (2 PDB entries)

8. Domain d1izea_: 1ize A: [83840]
   complexed with man

Details for d1izea_

PDB Entry: 1ize, 1.9 Å

PDB Description: crystal structure of aspergillus oryzae aspartic proteinase complexed with pepstatin

PDB Compounds: (A:) Aspartic proteinase

SCOPe Domain Sequences for d1izea_:

Sequence; same for both SEQRES and ATOM records:

>d1izea_ b.50.1.2 (A:) Acid protease {Fungus (Aspergillus oryzae) [TaxId: 5062]}
aatgsvttnptsndeeyitqvtvgddtlgldfdtgsadlwvfssqtpssersghdyytpg
ssaqkidgatwsisygdgssasgdvykdkvtvggvsydsqavesaekvsseftqdtandg
llglafssintvqptpqktffdnvksslsepifavalkhnapgvydfgytdsskytgsit
ytdvdnsqgfwgftadgysigsdsssdsitgiadtgttllllddsivdayyeqvngasyd
ssqggyvfpssaslpdfsvtigdytatvpgeyisfadvgngqtfggiqsnsgigfsifgd
vflksqyvvfdasgprlgfaaqa

Timeline for d1izea_:

• d1izea_ first appeared in SCOP 1.65
  
• d1izea_ appears in SCOPe 2.04
  
• d1izea_ appears in SCOPe 2.06
  
• d1izea_ appears in the current release, SCOPe 2.08