Class b: All beta proteins [48724] (176 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) |
Family b.50.1.2: Pepsin-like [50646] (11 proteins) duplication: consists of two similar barrel domains N-terminal: barrel, partly opened; n*=6, S*=10 |
Protein Acid protease [50649] (9 species) |
Species Fungus (Aspergillus oryzae) [TaxId:5062] [89352] (2 PDB entries) |
Domain d1izea_: 1ize A: [83840] complexed with man |
PDB Entry: 1ize (more details), 1.9 Å
SCOPe Domain Sequences for d1izea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1izea_ b.50.1.2 (A:) Acid protease {Fungus (Aspergillus oryzae) [TaxId: 5062]} aatgsvttnptsndeeyitqvtvgddtlgldfdtgsadlwvfssqtpssersghdyytpg ssaqkidgatwsisygdgssasgdvykdkvtvggvsydsqavesaekvsseftqdtandg llglafssintvqptpqktffdnvksslsepifavalkhnapgvydfgytdsskytgsit ytdvdnsqgfwgftadgysigsdsssdsitgiadtgttllllddsivdayyeqvngasyd ssqggyvfpssaslpdfsvtigdytatvpgeyisfadvgngqtfggiqsnsgigfsifgd vflksqyvvfdasgprlgfaaqa
Timeline for d1izea_: