Class b: All beta proteins [48724] (141 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (2 families) |
Family b.50.1.2: Pepsin-like [50646] (9 proteins) duplication: consists of two similar barrel domains N-terminal: barrel, partly opened; n*=6, S*=10 |
Protein Acid protease [50649] (8 species) |
Species Fungus (Aspergillus oryzae) [TaxId:5062] [89352] (2 PDB entries) |
Domain d1izda_: 1izd A: [83839] complexed with man |
PDB Entry: 1izd (more details), 1.9 Å
SCOP Domain Sequences for d1izda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1izda_ b.50.1.2 (A:) Acid protease {Fungus (Aspergillus oryzae)} aatgsvttnptsndeeyitqvtvgddtlgldfdtgsadlwvfssqtpssersghdyytpg ssaqkidgatwsisygdgssasgdvykdkvtvggvsydsqavesaekvsseftqdtandg llglafssintvqptpqktffdnvksslsepifavalkhnapgvydfgytdsskytgsit ytdvdnsqgfwgftadgysigsdsssdsitgiadtgttllllddsivdayyeqvngasyd ssqggyvfpssaslpdfsvtigdytatvpgeyisfadvgngqtfggiqsnsgigfsifgd vflksqyvvfdasgprlgfaaqa
Timeline for d1izda_: