Lineage for d1izda_ (1izd A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2799129Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2799130Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2800798Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2800799Protein Acid protease [50649] (9 species)
  7. 2800823Species Fungus (Aspergillus oryzae) [TaxId:5062] [89352] (2 PDB entries)
  8. 2800825Domain d1izda_: 1izd A: [83839]
    complexed with man

Details for d1izda_

PDB Entry: 1izd (more details), 1.9 Å

PDB Description: crystal structure of aspergillus oryzae aspartic proteinase
PDB Compounds: (A:) Aspartic proteinase

SCOPe Domain Sequences for d1izda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1izda_ b.50.1.2 (A:) Acid protease {Fungus (Aspergillus oryzae) [TaxId: 5062]}
aatgsvttnptsndeeyitqvtvgddtlgldfdtgsadlwvfssqtpssersghdyytpg
ssaqkidgatwsisygdgssasgdvykdkvtvggvsydsqavesaekvsseftqdtandg
llglafssintvqptpqktffdnvksslsepifavalkhnapgvydfgytdsskytgsit
ytdvdnsqgfwgftadgysigsdsssdsitgiadtgttllllddsivdayyeqvngasyd
ssqggyvfpssaslpdfsvtigdytatvpgeyisfadvgngqtfggiqsnsgigfsifgd
vflksqyvvfdasgprlgfaaqa

SCOPe Domain Coordinates for d1izda_:

Click to download the PDB-style file with coordinates for d1izda_.
(The format of our PDB-style files is described here.)

Timeline for d1izda_: