Lineage for d1izca_ (1izc A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 475982Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (6 families) (S)
  5. 476092Family c.1.12.5: HpcH/HpaI aldolase [51638] (3 proteins)
    forms a swapped dimer; contains a PK-type metal-binding site
  6. 476102Protein Macrophomate synthase [89501] (1 species)
    Intermolecular Diels-Alderase
  7. 476103Species Macrophoma commelinae [TaxId:108330] [89502] (1 PDB entry)
  8. 476104Domain d1izca_: 1izc A: [83838]

Details for d1izca_

PDB Entry: 1izc (more details), 1.7 Å

PDB Description: Crystal Structure Analysis of Macrophomate synthase

SCOP Domain Sequences for d1izca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1izca_ c.1.12.5 (A:) Macrophomate synthase {Macrophoma commelinae}
aksyseqpelhakapyrsamltypgnlrqalkdamadpsktlmgvahgipstfvtkvlaa
tkpdfvwidvehgmfnrlelhdaihaaqhhsegrslvivrvpkhdevslstaldagaagi
viphvetveevrefvkemyygpigrrsfspwtfspgiadaslfpndpynvatsnnhvcii
pqiesvkgvenvdaiaampeihglmfgpgdymidagldlngalsgvphptfveamtkfst
aaqrngvpifggalsvdmvpslieqgyraiavqfdvwglsrlvhgslaqarasakqfag

SCOP Domain Coordinates for d1izca_:

Click to download the PDB-style file with coordinates for d1izca_.
(The format of our PDB-style files is described here.)

Timeline for d1izca_: