SCOP 1.71: Domain d1iz5b1: 1iz5 B:2-120

Lineage for d1iz5b1 (1iz5 B:2-120)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (2 families)

5. Family d.131.1.2: DNA polymerase processivity factor [55983] (4 proteins)
   duplication: consists of two domains of this fold

6. Protein Proliferating cell nuclear antigen (PCNA) [55989] (5 species)

7. Species Archaeon Pyrococcus furiosus [TaxId:2261] [55992] (4 PDB entries)

8. Domain d1iz5b1: 1iz5 B:2-120 [83836]

Details for d1iz5b1

PDB Entry: 1iz5, 1.8 Å

PDB Description: pyrococcus furiosus pcna mutant (met73leu, asp143ala, asp147ala): orthorhombic form

SCOP Domain Sequences for d1iz5b1:

Sequence; same for both SEQRES and ATOM records:

>d1iz5b1 d.131.1.2 (B:2-120) Proliferating cell nuclear antigen (PCNA) {Archaeon Pyrococcus furiosus}
pfeivfegakefaqlidtasklideaafkvtedgismramdpsrvvlidlnlpssifsky
evvepetigvnldhlkkilkrgkakdtlilkkgeenfleitiqgtatrtfrvplidvee

Timeline for d1iz5b1:

• d1iz5b1 first appeared in SCOP 1.65
  
• d1iz5b1 appears in SCOP 1.69
  
• d1iz5b1 appears in SCOP 1.73
  
• d1iz5b1 appears in the current release, SCOPe 2.08