Lineage for d1iz5b1 (1iz5 B:2-120)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 611115Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 611116Superfamily d.131.1: DNA clamp [55979] (2 families) (S)
  5. 611157Family d.131.1.2: DNA polymerase processivity factor [55983] (4 proteins)
    duplication: consists of two domains of this fold
  6. 611179Protein Proliferating cell nuclear antigen (PCNA) [55989] (5 species)
  7. 611187Species Archaeon Pyrococcus furiosus [TaxId:2261] [55992] (4 PDB entries)
  8. 611190Domain d1iz5b1: 1iz5 B:2-120 [83836]

Details for d1iz5b1

PDB Entry: 1iz5 (more details), 1.8 Å

PDB Description: pyrococcus furiosus pcna mutant (met73leu, asp143ala, asp147ala): orthorhombic form

SCOP Domain Sequences for d1iz5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iz5b1 d.131.1.2 (B:2-120) Proliferating cell nuclear antigen (PCNA) {Archaeon Pyrococcus furiosus}
pfeivfegakefaqlidtasklideaafkvtedgismramdpsrvvlidlnlpssifsky
evvepetigvnldhlkkilkrgkakdtlilkkgeenfleitiqgtatrtfrvplidvee

SCOP Domain Coordinates for d1iz5b1:

Click to download the PDB-style file with coordinates for d1iz5b1.
(The format of our PDB-style files is described here.)

Timeline for d1iz5b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iz5b2