Lineage for d1iz1q2 (1iz1 Q:90-292)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 846191Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 846192Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 846193Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins)
  6. 846605Protein LysR-type regulatory protein CbnR [89789] (1 species)
  7. 846606Species Ralstonia eutropha [TaxId:106590] [89790] (2 PDB entries)
  8. 846612Domain d1iz1q2: 1iz1 Q:90-292 [83830]
    Other proteins in same PDB: d1iz1a1, d1iz1b1, d1iz1p1, d1iz1q1

Details for d1iz1q2

PDB Entry: 1iz1 (more details), 2.5 Å

PDB Description: crystal structure of cbnr, a lysr family transcriptional regulator
PDB Compounds: (Q:) LysR-type regulatory protein

SCOP Domain Sequences for d1iz1q2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iz1q2 c.94.1.1 (Q:90-292) LysR-type regulatory protein CbnR {Ralstonia eutropha [TaxId: 106590]}
vgelsvayfgtpiyrslplllrafltstptatvslthmtkdeqvegllagtihvgfsrff
prhpgieivniaqedlylavhrsqsgkfgktckladlraveltlfprggrpsfadevigl
fkhagiepriarvvedataalaltmagaassivpasvaairwpdiafarivgtrvkvpis
cifrkekqppilarfvehvrrsa

SCOP Domain Coordinates for d1iz1q2:

Click to download the PDB-style file with coordinates for d1iz1q2.
(The format of our PDB-style files is described here.)

Timeline for d1iz1q2: