Lineage for d1iz1q1 (1iz1 Q:1-89)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 438099Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 438531Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (55 families) (S)
    contains a small beta-sheet (wing)
  5. 439041Family a.4.5.37: LysR-like transcriptional regulators [88979] (1 protein)
    contains long helix in the C-terminal extension; forms dimer similar to the RTP dimer
  6. 439042Protein LysR-type regulatory protein CbnR [88980] (1 species)
  7. 439043Species Ralstonia eutropha [TaxId:106590] [88981] (2 PDB entries)
  8. 439049Domain d1iz1q1: 1iz1 Q:1-89 [83829]
    Other proteins in same PDB: d1iz1a2, d1iz1b2, d1iz1p2, d1iz1q2

Details for d1iz1q1

PDB Entry: 1iz1 (more details), 2.5 Å

PDB Description: crystal structure of cbnr, a lysr family transcriptional regulator

SCOP Domain Sequences for d1iz1q1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iz1q1 a.4.5.37 (Q:1-89) LysR-type regulatory protein CbnR {Ralstonia eutropha}
mefrqlkyfiavaeagnmaaaakrlhvsqppitrqmqaleadlgvvllershrgieltaa
ghafledarrilelagrsgdrsraaargd

SCOP Domain Coordinates for d1iz1q1:

Click to download the PDB-style file with coordinates for d1iz1q1.
(The format of our PDB-style files is described here.)

Timeline for d1iz1q1: