Lineage for d1iz1p2 (1iz1 P:90-292)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2914378Protein LysR-type regulatory protein CbnR [89789] (1 species)
  7. 2914379Species Ralstonia eutropha [TaxId:106590] [89790] (2 PDB entries)
  8. 2914384Domain d1iz1p2: 1iz1 P:90-292 [83828]
    Other proteins in same PDB: d1iz1a1, d1iz1b1, d1iz1p1, d1iz1q1

Details for d1iz1p2

PDB Entry: 1iz1 (more details), 2.5 Å

PDB Description: crystal structure of cbnr, a lysr family transcriptional regulator
PDB Compounds: (P:) LysR-type regulatory protein

SCOPe Domain Sequences for d1iz1p2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iz1p2 c.94.1.1 (P:90-292) LysR-type regulatory protein CbnR {Ralstonia eutropha [TaxId: 106590]}
vgelsvayfgtpiyrslplllrafltstptatvslthmtkdeqvegllagtihvgfsrff
prhpgieivniaqedlylavhrsqsgkfgktckladlraveltlfprggrpsfadevigl
fkhagiepriarvvedataalaltmagaassivpasvaairwpdiafarivgtrvkvpis
cifrkekqppilarfvehvrrsa

SCOPe Domain Coordinates for d1iz1p2:

Click to download the PDB-style file with coordinates for d1iz1p2.
(The format of our PDB-style files is described here.)

Timeline for d1iz1p2: