SCOP 1.75: Domain d1iz1p1: 1iz1 P:1-89

Lineage for d1iz1p1 (1iz1 P:1-89)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.37: LysR-like transcriptional regulators [88979] (2 proteins)
   contains long helix in the C-terminal extension; forms dimer similar to the RTP dimer

6. Protein LysR-type regulatory protein CbnR [88980] (1 species)

7. Species Ralstonia eutropha [TaxId:106590] [88981] (2 PDB entries)

8. Domain d1iz1p1: 1iz1 P:1-89 [83827]
   Other proteins in same PDB: d1iz1a2, d1iz1b2, d1iz1p2, d1iz1q2

Details for d1iz1p1

PDB Entry: 1iz1, 2.5 Å

PDB Description: crystal structure of cbnr, a lysr family transcriptional regulator

PDB Compounds: (P:) LysR-type regulatory protein

SCOP Domain Sequences for d1iz1p1:

Sequence; same for both SEQRES and ATOM records:

>d1iz1p1 a.4.5.37 (P:1-89) LysR-type regulatory protein CbnR {Ralstonia eutropha [TaxId: 106590]}
mefrqlkyfiavaeagnmaaaakrlhvsqppitrqmqaleadlgvvllershrgieltaa
ghafledarrilelagrsgdrsraaargd

Timeline for d1iz1p1:

• d1iz1p1 first appeared in SCOP 1.65
  
• d1iz1p1 appears in SCOP 1.73
  
• d1iz1p1 appears in SCOPe 2.01
  
• d1iz1p1 appears in the current release, SCOPe 2.08