SCOP 1.65: Domain d1iz1b2: 1iz1 B:90-294

Lineage for d1iz1b2 (1iz1 B:90-294)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (21 proteins)

6. Protein LysR-type regulatory protein CbnR [89789] (1 species)

7. Species Ralstonia eutropha [TaxId:106590] [89790] (2 PDB entries)

8. Domain d1iz1b2: 1iz1 B:90-294 [83826]
   Other proteins in same PDB: d1iz1a1, d1iz1b1, d1iz1p1, d1iz1q1

Details for d1iz1b2

PDB Entry: 1iz1, 2.5 Å

PDB Description: crystal structure of cbnr, a lysr family transcriptional regulator

SCOP Domain Sequences for d1iz1b2:

Sequence; same for both SEQRES and ATOM records:

>d1iz1b2 c.94.1.1 (B:90-294) LysR-type regulatory protein CbnR {Ralstonia eutropha}
vgelsvayfgtpiyrslplllrafltstptatvslthmtkdeqvegllagtihvgfsrff
prhpgieivniaqedlylavhrsqsgkfgktckladlraveltlfprggrpsfadevigl
fkhagiepriarvvedataalaltmagaassivpasvaairwpdiafarivgtrvkvpis
cifrkekqppilarfvehvrrsakd

Timeline for d1iz1b2:

• d1iz1b2 is new in SCOP 1.65
  
• d1iz1b2 appears in SCOP 1.67
  
• d1iz1b2 appears in the current release, SCOPe 2.08