SCOP 1.75: Domain d1iz1a2: 1iz1 A:90-292

Lineage for d1iz1a2 (1iz1 A:90-292)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins)

6. Protein LysR-type regulatory protein CbnR [89789] (1 species)

7. Species Ralstonia eutropha [TaxId:106590] [89790] (2 PDB entries)

8. Domain d1iz1a2: 1iz1 A:90-292 [83824]
   Other proteins in same PDB: d1iz1a1, d1iz1b1, d1iz1p1, d1iz1q1

Details for d1iz1a2

PDB Entry: 1iz1, 2.5 Å

PDB Description: crystal structure of cbnr, a lysr family transcriptional regulator

PDB Compounds: (A:) LysR-type regulatory protein

SCOP Domain Sequences for d1iz1a2:

Sequence; same for both SEQRES and ATOM records:

>d1iz1a2 c.94.1.1 (A:90-292) LysR-type regulatory protein CbnR {Ralstonia eutropha [TaxId: 106590]}
vgelsvayfgtpiyrslplllrafltstptatvslthmtkdeqvegllagtihvgfsrff
prhpgieivniaqedlylavhrsqsgkfgktckladlraveltlfprggrpsfadevigl
fkhagiepriarvvedataalaltmagaassivpasvaairwpdiafarivgtrvkvpis
cifrkekqppilarfvehvrrsa

Timeline for d1iz1a2:

• d1iz1a2 first appeared in SCOP 1.65
  
• d1iz1a2 appears in SCOP 1.73
  
• d1iz1a2 appears in SCOPe 2.01
  
• d1iz1a2 appears in the current release, SCOPe 2.08