Lineage for d1iz1a1 (1iz1 A:1-89)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 761866Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) (S)
    contains a small beta-sheet (wing)
  5. 762671Family a.4.5.37: LysR-like transcriptional regulators [88979] (2 proteins)
    contains long helix in the C-terminal extension; forms dimer similar to the RTP dimer
  6. 762672Protein LysR-type regulatory protein CbnR [88980] (1 species)
  7. 762673Species Ralstonia eutropha [TaxId:106590] [88981] (2 PDB entries)
  8. 762676Domain d1iz1a1: 1iz1 A:1-89 [83823]
    Other proteins in same PDB: d1iz1a2, d1iz1b2, d1iz1p2, d1iz1q2

Details for d1iz1a1

PDB Entry: 1iz1 (more details), 2.5 Å

PDB Description: crystal structure of cbnr, a lysr family transcriptional regulator
PDB Compounds: (A:) LysR-type regulatory protein

SCOP Domain Sequences for d1iz1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iz1a1 a.4.5.37 (A:1-89) LysR-type regulatory protein CbnR {Ralstonia eutropha [TaxId: 106590]}
mefrqlkyfiavaeagnmaaaakrlhvsqppitrqmqaleadlgvvllershrgieltaa
ghafledarrilelagrsgdrsraaargd

SCOP Domain Coordinates for d1iz1a1:

Click to download the PDB-style file with coordinates for d1iz1a1.
(The format of our PDB-style files is described here.)

Timeline for d1iz1a1: