SCOP 1.73: Domain d1iz0a2: 1iz0 A:99-269

Lineage for d1iz0a2 (1iz0 A:99-269)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (16 proteins)
   N-terminal all-beta domain defines family

6. Protein Quinone oxidoreductase [51747] (3 species)

7. Species Thermus thermophilus [TaxId:274] [89514] (2 PDB entries)

8. Domain d1iz0a2: 1iz0 A:99-269 [83822]
   Other proteins in same PDB: d1iz0a1
   complexed with mse, so4

Details for d1iz0a2

PDB Entry: 1iz0, 2.3 Å

PDB Description: Crystal Structures of the Quinone Oxidoreductase from Thermus thermophilus HB8 and Its Complex with NADPH

PDB Compounds: (A:) quinone oxidoreductase

SCOP Domain Sequences for d1iz0a2:

Sequence, based on SEQRES records:

>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]}
lspeeaaafpvsfltaylalkraqarpgekvlvqaaagalgtaavqvaramglrvlaaas
rpeklalplalgaeeaatyaevperakawggldlvlevrgkeveeslgllahggrlvyig
aaegevapipplrlmrrnlavlgfwltpllregalveealgfllprlgrel

Sequence, based on observed residues (ATOM records):

>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]}
lspeeaaafpvsfltaylalkraqarpgekvlvqaaagalgtaavqvaramglrvlaaas
rpeklalplalgaeeaatyaevperakawggldlvlevrgkeveeslgllahggrlvyia
pipplrlmrrnlavlgfwltpllregalveealgfllprlgrel

Timeline for d1iz0a2:

• d1iz0a2 first appeared in SCOP 1.65
  
• d1iz0a2 appears in SCOP 1.71
  
• d1iz0a2 appears in SCOP 1.75
  
• d1iz0a2 appears in the current release, SCOPe 2.08