Lineage for d1iz0a2 (1iz0 A:99-269)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 574151Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 574152Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 574153Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (16 proteins)
    N-terminal all-beta domain defines family
  6. 574441Protein Quinone oxidoreductase [51747] (3 species)
  7. 574448Species Thermus thermophilus [TaxId:274] [89514] (2 PDB entries)
  8. 574449Domain d1iz0a2: 1iz0 A:99-269 [83822]
    Other proteins in same PDB: d1iz0a1
    complexed with mse, so4

Details for d1iz0a2

PDB Entry: 1iz0 (more details), 2.3 Å

PDB Description: Crystal Structures of the Quinone Oxidoreductase from Thermus thermophilus HB8 and Its Complex with NADPH

SCOP Domain Sequences for d1iz0a2:

Sequence, based on SEQRES records: (download)

>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus}
lspeeaaafpvsfltaylalkraqarpgekvlvqaaagalgtaavqvaramglrvlaaas
rpeklalplalgaeeaatyaevperakawggldlvlevrgkeveeslgllahggrlvyig
aaegevapipplrlmrrnlavlgfwltpllregalveealgfllprlgrel

Sequence, based on observed residues (ATOM records): (download)

>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus}
lspeeaaafpvsfltaylalkraqarpgekvlvqaaagalgtaavqvaramglrvlaaas
rpeklalplalgaeeaatyaevperakawggldlvlevrgkeveeslgllahggrlvyia
pipplrlmrrnlavlgfwltpllregalveealgfllprlgrel

SCOP Domain Coordinates for d1iz0a2:

Click to download the PDB-style file with coordinates for d1iz0a2.
(The format of our PDB-style files is described here.)

Timeline for d1iz0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iz0a1