Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) |
Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (8 proteins) N-terminal all-beta domain defines family |
Protein Quinone oxidoreductase [51747] (2 species) |
Species Thermus thermophilus [TaxId:274] [89514] (2 PDB entries) |
Domain d1iz0a2: 1iz0 A:99-269 [83822] Other proteins in same PDB: d1iz0a1 complexed with mse, so4 |
PDB Entry: 1iz0 (more details), 2.3 Å
SCOP Domain Sequences for d1iz0a2:
Sequence, based on SEQRES records: (download)
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus} lspeeaaafpvsfltaylalkraqarpgekvlvqaaagalgtaavqvaramglrvlaaas rpeklalplalgaeeaatyaevperakawggldlvlevrgkeveeslgllahggrlvyig aaegevapipplrlmrrnlavlgfwltpllregalveealgfllprlgrel
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus} lspeeaaafpvsfltaylalkraqarpgekvlvqaaagalgtaavqvaramglrvlaaas rpeklalplalgaeeaatyaevperakawggldlvlevrgkeveeslgllahggrlvyia pipplrlmrrnlavlgfwltpllregalveealgfllprlgrel
Timeline for d1iz0a2: