Lineage for d1iz0a1 (1iz0 A:1-98,A:270-302)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 558060Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 558061Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 558147Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 558431Protein Quinone oxidoreductase [50147] (3 species)
  7. 558438Species Thermus thermophilus [TaxId:274] [89308] (2 PDB entries)
  8. 558439Domain d1iz0a1: 1iz0 A:1-98,A:270-302 [83821]
    Other proteins in same PDB: d1iz0a2
    complexed with mse, so4

Details for d1iz0a1

PDB Entry: 1iz0 (more details), 2.3 Å

PDB Description: Crystal Structures of the Quinone Oxidoreductase from Thermus thermophilus HB8 and Its Complex with NADPH

SCOP Domain Sequences for d1iz0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iz0a1 b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase {Thermus thermophilus}
mkawvlkrlggplelvdlpepeaeegevvlrveavglnfadhlmrlgayltrlhppfipg
mevvgvvegrryaalvpqgglaervavpkgallplpegXrpvvgpvfpfaeaeaafrall
drghtgkvvvrl

SCOP Domain Coordinates for d1iz0a1:

Click to download the PDB-style file with coordinates for d1iz0a1.
(The format of our PDB-style files is described here.)

Timeline for d1iz0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iz0a2