![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.35: GroES-like [50128] (2 superfamilies) contains barrel, partly opened; n*=4, S*=8; meander |
![]() | Superfamily b.35.1: GroES-like [50129] (2 families) ![]() |
![]() | Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins) C-terminal domain is alpha/beta (classical Rossmann-fold) |
![]() | Protein Quinone oxidoreductase [50147] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [89308] (2 PDB entries) |
![]() | Domain d1iz0a1: 1iz0 A:1-98,A:270-302 [83821] Other proteins in same PDB: d1iz0a2 complexed with mse, so4 |
PDB Entry: 1iz0 (more details), 2.3 Å
SCOP Domain Sequences for d1iz0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iz0a1 b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase {Thermus thermophilus} mkawvlkrlggplelvdlpepeaeegevvlrveavglnfadhlmrlgayltrlhppfipg mevvgvvegrryaalvpqgglaervavpkgallplpegXrpvvgpvfpfaeaeaafrall drghtgkvvvrl
Timeline for d1iz0a1: