Lineage for d1iyza2 (1iyz A:99-269)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 307887Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 307888Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 307889Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (8 proteins)
    N-terminal all-beta domain defines family
  6. 308068Protein Quinone oxidoreductase [51747] (2 species)
  7. 308072Species Thermus thermophilus [TaxId:274] [89514] (2 PDB entries)
  8. 308074Domain d1iyza2: 1iyz A:99-269 [83820]
    Other proteins in same PDB: d1iyza1
    complexed with ndp

Details for d1iyza2

PDB Entry: 1iyz (more details), 2.8 Å

PDB Description: Crystal Structures of the Quinone Oxidoreductase from Thermus thermophilus HB8 and Its Complex with NADPH

SCOP Domain Sequences for d1iyza2:

Sequence, based on SEQRES records: (download)

>d1iyza2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus}
lspeeaaafpvsfltaylalkraqarpgekvlvqaaagalgtaavqvaramglrvlaaas
rpeklalplalgaeeaatyaevperakawggldlvlevrgkeveeslgllahggrlvyig
aaegevapipplrlmrrnlavlgfwltpllregalveealgfllprlgrel

Sequence, based on observed residues (ATOM records): (download)

>d1iyza2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus}
lspeeaaafpvsfltaylalkraqarpgekvlvqaaagalgtaavqvaramglrvlaaas
rpeklalplalgaeeaatyaevperakawggldlvlevrgkeveeslgllahggrlvyig
aaeapipplrlmrrnlavlgfwltpllregalveealgfllprlgrel

SCOP Domain Coordinates for d1iyza2:

Click to download the PDB-style file with coordinates for d1iyza2.
(The format of our PDB-style files is described here.)

Timeline for d1iyza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iyza1