SCOP 1.65: Domain d1iyza2: 1iyz A:99-269

Lineage for d1iyza2 (1iyz A:99-269)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families)

5. Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (8 proteins)
   N-terminal all-beta domain defines family

6. Protein Quinone oxidoreductase [51747] (2 species)

7. Species Thermus thermophilus [TaxId:274] [89514] (2 PDB entries)

8. Domain d1iyza2: 1iyz A:99-269 [83820]
   Other proteins in same PDB: d1iyza1
   complexed with ndp

Details for d1iyza2

PDB Entry: 1iyz, 2.8 Å

PDB Description: Crystal Structures of the Quinone Oxidoreductase from Thermus thermophilus HB8 and Its Complex with NADPH

SCOP Domain Sequences for d1iyza2:

Sequence, based on SEQRES records:

>d1iyza2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus}
lspeeaaafpvsfltaylalkraqarpgekvlvqaaagalgtaavqvaramglrvlaaas
rpeklalplalgaeeaatyaevperakawggldlvlevrgkeveeslgllahggrlvyig
aaegevapipplrlmrrnlavlgfwltpllregalveealgfllprlgrel

Sequence, based on observed residues (ATOM records):

>d1iyza2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus}
lspeeaaafpvsfltaylalkraqarpgekvlvqaaagalgtaavqvaramglrvlaaas
rpeklalplalgaeeaatyaevperakawggldlvlevrgkeveeslgllahggrlvyig
aaeapipplrlmrrnlavlgfwltpllregalveealgfllprlgrel

Timeline for d1iyza2:

• d1iyza2 is new in SCOP 1.65
  
• d1iyza2 appears in SCOP 1.67
  
• d1iyza2 appears in the current release, SCOPe 2.08