Lineage for d1iyza1 (1iyz A:1-98,A:270-302)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2394951Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 2394952Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 2395084Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 2395429Protein Quinone oxidoreductase [50147] (3 species)
  7. 2395436Species Thermus thermophilus [TaxId:274] [89308] (2 PDB entries)
  8. 2395438Domain d1iyza1: 1iyz A:1-98,A:270-302 [83819]
    Other proteins in same PDB: d1iyza2
    complexed with ndp

Details for d1iyza1

PDB Entry: 1iyz (more details), 2.8 Å

PDB Description: Crystal Structures of the Quinone Oxidoreductase from Thermus thermophilus HB8 and Its Complex with NADPH
PDB Compounds: (A:) quinone oxidoreductase

SCOPe Domain Sequences for d1iyza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iyza1 b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]}
mkawvlkrlggplelvdlpepeaeegevvlrveavglnfadhlmrlgayltrlhppfipg
mevvgvvegrryaalvpqgglaervavpkgallplpegXrpvvgpvfpfaeaeaafrall
drghtgkvvvrl

SCOPe Domain Coordinates for d1iyza1:

Click to download the PDB-style file with coordinates for d1iyza1.
(The format of our PDB-style files is described here.)

Timeline for d1iyza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iyza2