Lineage for d1iyza1 (1iyz A:1-98,A:270-302)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373088Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 373089Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 373153Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (11 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 373392Protein Quinone oxidoreductase [50147] (2 species)
  7. 373396Species Thermus thermophilus [TaxId:274] [89308] (2 PDB entries)
  8. 373398Domain d1iyza1: 1iyz A:1-98,A:270-302 [83819]
    Other proteins in same PDB: d1iyza2
    complexed with ndp

Details for d1iyza1

PDB Entry: 1iyz (more details), 2.8 Å

PDB Description: Crystal Structures of the Quinone Oxidoreductase from Thermus thermophilus HB8 and Its Complex with NADPH

SCOP Domain Sequences for d1iyza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iyza1 b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase {Thermus thermophilus}
mkawvlkrlggplelvdlpepeaeegevvlrveavglnfadhlmrlgayltrlhppfipg
mevvgvvegrryaalvpqgglaervavpkgallplpegXrpvvgpvfpfaeaeaafrall
drghtgkvvvrl

SCOP Domain Coordinates for d1iyza1:

Click to download the PDB-style file with coordinates for d1iyza1.
(The format of our PDB-style files is described here.)

Timeline for d1iyza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iyza2