| Class b: All beta proteins [48724] (126 folds) |
| Fold b.35: GroES-like [50128] (2 superfamilies) contains barrel, partly opened; n*=4, S*=8; meander |
Superfamily b.35.1: GroES-like [50129] (2 families) ![]() |
| Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (7 proteins) C-terminal domain is alpha/beta (classical Rossmann-fold) |
| Protein Quinone oxidoreductase [50147] (2 species) |
| Species Thermus thermophilus [TaxId:274] [89308] (2 PDB entries) |
| Domain d1iyza1: 1iyz A:1-98,A:270-302 [83819] Other proteins in same PDB: d1iyza2 complexed with ndp |
PDB Entry: 1iyz (more details), 2.8 Å
SCOP Domain Sequences for d1iyza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iyza1 b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase {Thermus thermophilus}
mkawvlkrlggplelvdlpepeaeegevvlrveavglnfadhlmrlgayltrlhppfipg
mevvgvvegrryaalvpqgglaervavpkgallplpegXrpvvgpvfpfaeaeaafrall
drghtgkvvvrl
Timeline for d1iyza1: