SCOPe 2.08: Domain d1iyza1: 1iyz A:1-98,A:270-302

Lineage for d1iyza1 (1iyz A:1-98,A:270-302)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (3 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein Quinone oxidoreductase [50147] (3 species)

7. Species Thermus thermophilus [TaxId:274] [89308] (2 PDB entries)

8. Domain d1iyza1: 1iyz A:1-98,A:270-302 [83819]
   Other proteins in same PDB: d1iyza2
   complexed with ndp

Details for d1iyza1

PDB Entry: 1iyz, 2.8 Å

PDB Description: Crystal Structures of the Quinone Oxidoreductase from Thermus thermophilus HB8 and Its Complex with NADPH

PDB Compounds: (A:) quinone oxidoreductase

SCOPe Domain Sequences for d1iyza1:

Sequence; same for both SEQRES and ATOM records:

>d1iyza1 b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]}
mkawvlkrlggplelvdlpepeaeegevvlrveavglnfadhlmrlgayltrlhppfipg
mevvgvvegrryaalvpqgglaervavpkgallplpegXrpvvgpvfpfaeaeaafrall
drghtgkvvvrl

Timeline for d1iyza1:

• d1iyza1 first appeared in SCOP 1.65
  
• d1iyza1 appears in SCOPe 2.07