| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
| Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins) C-terminal domain is beta/alpha-barrel |
| Protein Enolase [54828] (9 species) |
| Species Enterococcus hirae [TaxId:1354] [89926] (1 PDB entry) |
| Domain d1iyxb2: 1iyx B:1-136 [83818] Other proteins in same PDB: d1iyxa1, d1iyxb1 complexed with gol, mg, so4 |
PDB Entry: 1iyx (more details), 2.8 Å
SCOPe Domain Sequences for d1iyxb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iyxb2 d.54.1.1 (B:1-136) Enolase {Enterococcus hirae [TaxId: 1354]}
siitdvyareildsrgnptievevytesgafgrgmvpsgastgeyeavelrdgdkarygg
kgvtkavdnvnniiaeaiigydvrdqmaidkamialdgtpnkgklganailgvsiavara
aadylevplyhylggf
Timeline for d1iyxb2: