Lineage for d1iywb4 (1iyw B:1-189,B:343-578)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1160658Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1160659Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1160660Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 1160863Protein Valyl-tRNA synthetase (ValRS) [52390] (1 species)
  7. 1160864Species Thermus thermophilus [TaxId:274] [52391] (3 PDB entries)
  8. 1160870Domain d1iywb4: 1iyw B:1-189,B:343-578 [83814]
    Other proteins in same PDB: d1iywa1, d1iywa2, d1iywa3, d1iywb1, d1iywb2, d1iywb3
    preliminary structure of ligand-free enzyme; CA-atoms only

Details for d1iywb4

PDB Entry: 1iyw (more details), 4 Å

PDB Description: preliminary structure of thermus thermophilus ligand-free valyl-trna synthetase
PDB Compounds: (B:) valyl-tRNA synthetase

SCOPe Domain Sequences for d1iywb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iywb4 c.26.1.1 (B:1-189,B:343-578) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus [TaxId: 274]}
mdlpkaydpksvepkwaekwaknpfvanpksgkppfvifmpppnvtgslhmghaldnslq
dalirykrmrgfeavwlpgtdhagiatqvvverlllkegktrhdlgrekflervwqwkee
sggtilkqlkrlgasadwsreaftmdekrsravryafsryyheglayraprlvnwcprce
ttlsdleveXtcsrcgtpieyaifpqwwlrmrplaeevlkglrrgdiafvperwkkvnmd
wlenvkdwnisrqlwwghqipawycedcqavnvprperyledptsceacgsprlkrdedv
fdtwfssalwplstlgwpeetedlkafypgdvlvtgydilflwvsrmevsgyhfmgerpf
ktvllhglvldekgqkmskskgnvidplemverygadalrfaliylatggqdirldlrwl
emarnf

SCOPe Domain Coordinates for d1iywb4:

Click to download the PDB-style file with coordinates for d1iywb4.
(The format of our PDB-style files is described here.)

Timeline for d1iywb4: