Class b: All beta proteins [48724] (174 folds) |
Fold b.51: ValRS/IleRS/LeuRS editing domain [50676] (1 superfamily) core: barrel, closed; n=6, S=8; topology is similar to that of the acid proteases barrel |
Superfamily b.51.1: ValRS/IleRS/LeuRS editing domain [50677] (1 family) |
Family b.51.1.1: ValRS/IleRS/LeuRS editing domain [50678] (3 proteins) inserted into the catalytic domain |
Protein Valyl-tRNA synthetase (ValRS) [50682] (1 species) |
Species Thermus thermophilus [TaxId:274] [50683] (5 PDB entries) |
Domain d1iywb3: 1iyw B:190-342 [83813] Other proteins in same PDB: d1iywa1, d1iywa2, d1iywa4, d1iywb1, d1iywb2, d1iywb4 preliminary structure of ligand-free enzyme; CA-atoms only |
PDB Entry: 1iyw (more details), 4 Å
SCOPe Domain Sequences for d1iywb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iywb3 b.51.1.1 (B:190-342) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus [TaxId: 274]} teptpgklytlryevegggfieiatvrpetvfadqaiavhpederyrhllgkrariplte vwipiladpavekdfgtgalkvtpahdpldyeigerhglkpvsvinlegrmegervpeal rgldrfearrkavelfreaghlvkeedytiala
Timeline for d1iywb3:
View in 3D Domains from other chains: (mouse over for more information) d1iywa1, d1iywa2, d1iywa3, d1iywa4 |